Stathmin 4
WebAbstract. The findings that amyotrophic lateral sclerosis (ALS) patients almost universally display pathological mislocalization of the RNA-binding protein TDP-43 and that … WebStathmin-4. F. 1: Tubulin Tyrosine Ligase. Chemicals and Non-standard biopolymers (20 molecules) 1. 2. GUANOSINE-5'-TRIPHOSPHATE (Link to PubChem not yet available) 2. 5. MAGNESIUM ION (Link to PubChem not yet available) 3. 4. CALCIUM ION (Link to PubChem not yet available) 4. 1.
Stathmin 4
Did you know?
WebThe cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 15 minutes, and blocked with 2% BSA for 45 minutes at room … WebFeb 19, 2024 · Stathmin expression is associated with aggressive tumour features Immunohistochemical staining of stathmin protein was mainly localised in the tumour cell cytoplasm, and was recorded as high in...
WebNov 7, 2016 · By studying the developing zebrafish brain, we observed a specific and dynamic expression of a microtubule destabilizer gene, stathmin-like 4 (stmn4), in the … WebApr 11, 2024 · Stathmin 1 acts as a microtubule destabilizer by interacting with αβ-tubulin heterodimers and inhibiting microtubule polymerization. Stathmin 1 has two functional domains: The N-terminus domain facilitates microtubule depolymerization, and the C-terminus domain is indispensable for tubulin dimer binding and sequestering [ 12 ].
Stathmin, also known as metablastin and oncoprotein 18 is a protein that in humans is encoded by the STMN1 gene. Stathmin is a highly conserved 17 kDa protein that is crucial for the regulation of the cell cytoskeleton. Changes in the cytoskeleton are important because the cytoskeleton is a scaffold required for … See more Stathmin, and the related proteins SCG10 and XB3, contain a N-terminal domain (XB3 contains an additional N-terminal hydrophobic region), a 78 amino acid coiled-coil region, and a short C-terminal domain. See more The function of Stathmin is to regulate the cytoskeleton of the cell. The cytoskeleton is made up of long hollow cylinders named microtubules. … See more Stathmin's role in regulation of the cell cycle causes it to be an oncoprotein named oncoprotein 18 (op18). Stathmin (aka op18) can cause … See more • Sobel A (August 1991). "Stathmin: a relay phosphoprotein for multiple signal transduction?". Trends in Biochemical Sciences. 16 (8): 301–5. doi:10.1016/0968-0004(91)90123-D See more Stathmin interacts with two molecules of dimeric α,β-tubulin to form a tight ternary complex called the T2S complex. One mole of stathmin … See more Mice without stathmin have deficiency in innate and learned fear. Stathmin−/− females do not assess threats well, leading to lack of innate parental care and adult social interactions. They lack motivation for retrieving pups and are unable to choose a … See more • NLM • Stathmin.com See more WebRB3 (Stathmin-4), encoded by STMN4 gene, is a neuron-specific homologue of the SCG10/stathmin family proteins, possessing a unique N-terminal membrane-associated domain and the stathmin-like domain at the C terminus, which promotes microtubule (MT) catastrophe and/or tubulin sequestering. Stathmin is a ubiquitous cytosolic …
WebNov 7, 2016 · Stathmin-like 4 is critical for the maintenance of neural progenitor cells in dorsal midbrain of zebrafish larvae. Meng-Ju Lin &. Shyh-Jye Lee. Scientific Reports 6, …
WebSep 26, 2024 · Stmn4 stathmin-like 4 [ (house mouse)] Gene ID: 56471, updated on 26-Sep-2024 Summary Predicted to enable tubulin binding activity. Predicted to be involved in … can you search for people on the meetme appWebApr 4, 2024 · 4. Other autoantibodies 4.1. Anti-centromere autoantibodies Anti-centromere antibodies (ACA) are directed to six antigens associated with centromere (composed of a complex of kinetochore proteins). Currently identified anti-centromere antibodies (CENP) have been assigned designations with letters from A to F. brinks complaintsWebStathmin-4 Details Name Stathmin-4 Synonyms RB3 Stathmin-like protein B3 Gene Name STMN4 Organism Humans Amino acid sequence >lcl BSEQ0007654 Stathmin-4 MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTS GQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR … brinks components b.vWebNov 14, 2024 · So far, four stathmins have been distinguished. All stathmins seem to interact with the tubulin network. STMN4 can be found within the Golgi apparatus, the … can you search for words in imessageWebSep 9, 1997 · Stathmin is an important regulatory protein thought to control the dynamics of microtubules through the cell cycle in a phosphorylation-dependent manner. Here we show that stathmin interacts with two molecules of dimeric αβ−tubulin to form a tight ternary T2S complex, sedimenting at 7.7 S. This complex appears in slow association−dissociation … brinks compusafe portal webWebStathmin has been investigated as a tumor biomarker because it appear to be associated with tumorigenesis; however, the effect of stathmin in lung adenocarcinoma (LAC) remains poorly understood. brinks compusafe series 4WebMar 21, 2024 · Stathmin proteins function in microtubule dynamics and signal transduction. The encoded protein plays a regulatory role in neuronal growth and is also thought to be involved in osteogenesis. Reductions in the expression of this gene have been associated with Down's syndrome and Alzheimer's disease. brinks complete safe